PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0106200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 540aa    MW: 61315 Da    PI: 4.716
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0106200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.3e-1364103141
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 
                        r rW+t Ede l++ ++ +G ++W+t+ar ++ gR + qc+
  ORGLA02G0106200.1  64 RRRWSTKEDESLIQMINIYGHNNWETVARAIP-GRNAQQCR 103
                        78******************************.*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.73659114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-1261103IPR009057Homeodomain-like
SuperFamilySSF466891.17E-1062103IPR009057Homeodomain-like
SMARTSM007174.0E-763112IPR001005SANT/Myb domain
PfamPF002491.6E-964103IPR001005SANT/Myb domain
CDDcd001671.07E-1066103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MASRAVEGEG EGEEEGEGKG NLANAPEDSH KHCQGEELEA GQSCKINYQD IMDKCGIEIS  60
EKRRRRWSTK EDESLIQMIN IYGHNNWETV ARAIPGRNAQ QCRVXXXXXX XXXXXXXXXX  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXQGASSK CDGSSGENQL LSDLQASLMS KQRTSSKYKQ  360
GASSKSKQGT SSKSKQGFID LCENTDTSEG ESSELICTER PDPDSGEASQ RIRDRLNWRK  420
RARKKLVFLS SPVELKVSAV AESERHLQES KEMSPEVNIV SPPAVLQGFS PEVPSVCEKI  480
VEPPLADFNQ AKNVCSLETS SDPCTLEQHL ANVSDLLDMS YIDGLMIIPP AGCPYDGDFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4957890.0AJ495789.1 Oryza sativa Japonica Group partial mRNA for MYB20 protein.
GenBankAK1209130.0AK120913.1 Oryza sativa Japonica Group cDNA clone:J023034G08, full insert sequence.
GenBankAP0050070.0AP005007.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0521F09.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622738.11e-145PREDICTED: myb-like protein Q
TrEMBLA0A0D3F3F81e-148A0A0D3F3F8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G4T11e-149A0A0E0G4T1_ORYNI; Uncharacterized protein
STRINGORGLA02G0106200.11e-147(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP165241011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-07myb domain protein 3r-4